Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60928..61182 | Replicon | plasmid p1 |
| Accession | NZ_CP104534 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N5O77_RS25415 | Protein ID | WP_001312851.1 |
| Coordinates | 60928..61077 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 61121..61182 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS25380 (57255) | 57255..57542 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N5O77_RS25385 (57539) | 57539..57790 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| N5O77_RS25390 (58756) | 58756..59613 | - | 858 | WP_153789778.1 | incFII family plasmid replication initiator RepA | - |
| N5O77_RS25395 (59606) | 59606..60088 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| N5O77_RS25400 (60081) | 60081..60128 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| N5O77_RS25405 (60119) | 60119..60370 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| N5O77_RS25410 (60387) | 60387..60644 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| N5O77_RS25415 (60928) | 60928..61077 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (61121) | 61121..61182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (61121) | 61121..61182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (61121) | 61121..61182 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (61121) | 61121..61182 | + | 62 | NuclAT_1 | - | Antitoxin |
| N5O77_RS25420 (61438) | 61438..61512 | - | 75 | Protein_59 | endonuclease | - |
| N5O77_RS25425 (61758) | 61758..61970 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| N5O77_RS25430 (62106) | 62106..62666 | - | 561 | WP_102596227.1 | fertility inhibition protein FinO | - |
| N5O77_RS25435 (62769) | 62769..63629 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| N5O77_RS25440 (63688) | 63688..64434 | - | 747 | WP_102596226.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..133669 | 133669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T258342 WP_001312851.1 NZ_CP104534:c61077-60928 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT258342 NZ_CP104534:61121-61182 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|