Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4870432..4871034 | Replicon | chromosome |
| Accession | NZ_CP104533 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N5O77_RS24105 | Protein ID | WP_000897302.1 |
| Coordinates | 4870723..4871034 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5O77_RS24100 | Protein ID | WP_000356397.1 |
| Coordinates | 4870432..4870722 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS24075 (4866505) | 4866505..4867407 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N5O77_RS24080 (4867404) | 4867404..4868039 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5O77_RS24085 (4868036) | 4868036..4868965 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| N5O77_RS24090 (4869181) | 4869181..4869399 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| N5O77_RS24095 (4869795) | 4869795..4870073 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| N5O77_RS24100 (4870432) | 4870432..4870722 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N5O77_RS24105 (4870723) | 4870723..4871034 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N5O77_RS24110 (4871263) | 4871263..4872171 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
| N5O77_RS24115 (4872235) | 4872235..4873176 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N5O77_RS24120 (4873221) | 4873221..4873658 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| N5O77_RS24125 (4873655) | 4873655..4874527 | - | 873 | WP_261175552.1 | virulence factor BrkB family protein | - |
| N5O77_RS24130 (4874521) | 4874521..4875120 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T258340 WP_000897302.1 NZ_CP104533:c4871034-4870723 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|