Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3856890..3857584 | Replicon | chromosome |
Accession | NZ_CP104533 | ||
Organism | Escherichia coli strain E10 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | N5O77_RS19220 | Protein ID | WP_001263500.1 |
Coordinates | 3856890..3857288 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | N5O77_RS19225 | Protein ID | WP_000554758.1 |
Coordinates | 3857291..3857584 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O77_RS19195 (3852255) | 3852255..3852713 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
N5O77_RS19200 (3852974) | 3852974..3854431 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
N5O77_RS19205 (3854488) | 3854488..3855102 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
N5O77_RS19210 (3855099) | 3855099..3856238 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
N5O77_RS19215 (3856428) | 3856428..3856880 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
N5O77_RS19220 (3856890) | 3856890..3857288 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N5O77_RS19225 (3857291) | 3857291..3857584 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N5O77_RS19230 (3857636) | 3857636..3858691 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
N5O77_RS19235 (3858762) | 3858762..3859547 | - | 786 | WP_000207544.1 | putative lateral flagellar export/assembly protein LafU | - |
N5O77_RS19240 (3859519) | 3859519..3861231 | + | 1713 | Protein_3770 | flagellar biosynthesis protein FlhA | - |
N5O77_RS19245 (3861310) | 3861310..3861468 | + | 159 | WP_014639450.1 | hypothetical protein | - |
N5O77_RS19250 (3861551) | 3861551..3862048 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3856890..3877244 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T258331 WP_001263500.1 NZ_CP104533:c3857288-3856890 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|