Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3627970..3628649 | Replicon | chromosome |
Accession | NZ_CP104533 | ||
Organism | Escherichia coli strain E10 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5O77_RS18165 | Protein ID | WP_261175519.1 |
Coordinates | 3628347..3628649 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | N5O77_RS18160 | Protein ID | WP_000806442.1 |
Coordinates | 3627970..3628311 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O77_RS18150 (3624214) | 3624214..3625146 | - | 933 | WP_000883052.1 | glutaminase A | - |
N5O77_RS18155 (3625408) | 3625408..3627912 | + | 2505 | WP_000083945.1 | copper-exporting P-type ATPase CopA | - |
N5O77_RS18160 (3627970) | 3627970..3628311 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
N5O77_RS18165 (3628347) | 3628347..3628649 | - | 303 | WP_261175519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O77_RS18170 (3628782) | 3628782..3629576 | + | 795 | WP_000365177.1 | TraB/GumN family protein | - |
N5O77_RS18175 (3629780) | 3629780..3630259 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
N5O77_RS18180 (3630283) | 3630283..3631083 | + | 801 | WP_000439796.1 | hypothetical protein | - |
N5O77_RS18185 (3631080) | 3631080..3631583 | + | 504 | WP_000667000.1 | hypothetical protein | - |
N5O77_RS18190 (3631621) | 3631621..3633273 | - | 1653 | WP_001513633.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3620659..3631583 | 10924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11825.40 Da Isoelectric Point: 10.0576
>T258329 WP_261175519.1 NZ_CP104533:c3628649-3628347 [Escherichia coli]
MAQNKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQNKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHWDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|