Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3783242..3783936 | Replicon | chromosome |
| Accession | NZ_CP104526 | ||
| Organism | Escherichia coli strain E8 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | N5O73_RS18515 | Protein ID | WP_001263493.1 |
| Coordinates | 3783242..3783640 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N5O73_RS18520 | Protein ID | WP_000554757.1 |
| Coordinates | 3783643..3783936 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3778902) | 3778902..3778982 | - | 81 | NuclAT_8 | - | - |
| - (3778902) | 3778902..3778982 | - | 81 | NuclAT_8 | - | - |
| - (3778902) | 3778902..3778982 | - | 81 | NuclAT_8 | - | - |
| - (3778902) | 3778902..3778982 | - | 81 | NuclAT_8 | - | - |
| N5O73_RS18485 (3778242) | 3778242..3779486 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| N5O73_RS18490 (3779578) | 3779578..3780036 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N5O73_RS18495 (3780297) | 3780297..3781754 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| N5O73_RS18500 (3781811) | 3781811..3782332 | - | 522 | Protein_3623 | peptide chain release factor H | - |
| N5O73_RS18505 (3782331) | 3782331..3782534 | - | 204 | Protein_3624 | RtcB family protein | - |
| N5O73_RS18510 (3782780) | 3782780..3783232 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| N5O73_RS18515 (3783242) | 3783242..3783640 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5O73_RS18520 (3783643) | 3783643..3783936 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5O73_RS18525 (3783988) | 3783988..3785043 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N5O73_RS18530 (3785114) | 3785114..3785899 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5O73_RS18535 (3785871) | 3785871..3787583 | + | 1713 | Protein_3630 | flagellar biosynthesis protein FlhA | - |
| N5O73_RS18540 (3787799) | 3787799..3788296 | - | 498 | WP_000006256.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T258309 WP_001263493.1 NZ_CP104526:c3783640-3783242 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|