Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 63768..64032 Replicon plasmid p2
Accession NZ_CP104525
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag N5O80_RS26340 Protein ID WP_001331364.1
Coordinates 63880..64032 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 63768..63825 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS26325 (60078) 60078..61298 - 1221 Protein_69 conjugal transfer protein TrbC -
N5O80_RS26330 (61291) 61291..62361 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
N5O80_RS26335 (62380) 62380..63588 - 1209 WP_000121274.1 IncI1-type conjugal transfer protein TrbA -
- (63768) 63768..63825 - 58 NuclAT_0 - Antitoxin
- (63768) 63768..63825 - 58 NuclAT_0 - Antitoxin
- (63768) 63768..63825 - 58 NuclAT_0 - Antitoxin
- (63768) 63768..63825 - 58 NuclAT_0 - Antitoxin
N5O80_RS26340 (63880) 63880..64032 + 153 WP_001331364.1 Hok/Gef family protein Toxin
N5O80_RS26345 (64104) 64104..64244 - 141 WP_000880644.1 hypothetical protein -
N5O80_RS26350 (64655) 64655..64951 + 297 WP_001275298.1 DinQ-like type I toxin DqlB -
N5O80_RS26355 (65016) 65016..65192 - 177 WP_001054904.1 hypothetical protein -
N5O80_RS26360 (65584) 65584..65793 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
N5O80_RS26365 (65865) 65865..66527 - 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
N5O80_RS26370 (66592) 66592..68754 - 2163 WP_000698351.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aac(3)-VIa / ant(3'')-Ia - 1..111369 111369


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T258293 WP_001331364.1 NZ_CP104525:63880-64032 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT258293 NZ_CP104525:c63825-63768 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References