Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5148935..5149537 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N5O80_RS25090 | Protein ID | WP_000897305.1 |
Coordinates | 5148935..5149246 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5O80_RS25095 | Protein ID | WP_000356397.1 |
Coordinates | 5149247..5149537 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS25065 (5144849) | 5144849..5145448 | + | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
N5O80_RS25070 (5145442) | 5145442..5146314 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N5O80_RS25075 (5146311) | 5146311..5146748 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N5O80_RS25080 (5146793) | 5146793..5147734 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N5O80_RS25085 (5147798) | 5147798..5148706 | - | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
N5O80_RS25090 (5148935) | 5148935..5149246 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N5O80_RS25095 (5149247) | 5149247..5149537 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N5O80_RS25100 (5150142) | 5150142..5150360 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N5O80_RS25105 (5150575) | 5150575..5151504 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
N5O80_RS25110 (5151501) | 5151501..5152136 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5O80_RS25115 (5152133) | 5152133..5153035 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258290 WP_000897305.1 NZ_CP104523:5148935-5149246 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|