Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4659897..4660119 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | N5O80_RS22750 | Protein ID | WP_001295224.1 |
| Coordinates | 4659897..4660004 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4660061..4660119 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS22725 | 4655203..4655391 | - | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
| N5O80_RS22730 | 4655664..4657235 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| N5O80_RS22735 | 4657232..4657423 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| N5O80_RS22740 | 4657420..4659099 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| N5O80_RS22745 | 4659214..4659672 | - | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| N5O80_RS22750 | 4659897..4660004 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4660061..4660119 | + | 59 | - | - | Antitoxin |
| N5O80_RS22755 | 4660380..4660487 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O80_RS22760 | 4660863..4660970 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O80_RS22765 | 4661346..4661453 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O80_RS22770 | 4661929..4663200 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| N5O80_RS22775 | 4663230..4664234 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4659214..4659672 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T258286 WP_001295224.1 NZ_CP104523:c4660004-4659897 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 59 bp
>AT258286 NZ_CP104523:4660061-4660119 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|