Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4659897..4660119 Replicon chromosome
Accession NZ_CP104523
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag N5O80_RS22750 Protein ID WP_001295224.1
Coordinates 4659897..4660004 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4660061..4660119 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS22725 4655203..4655391 - 189 WP_001063315.1 cellulose biosynthesis protein BcsR -
N5O80_RS22730 4655664..4657235 + 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
N5O80_RS22735 4657232..4657423 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
N5O80_RS22740 4657420..4659099 + 1680 WP_001562264.1 cellulose biosynthesis protein BcsG -
N5O80_RS22745 4659214..4659672 - 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
N5O80_RS22750 4659897..4660004 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4660061..4660119 + 59 - - Antitoxin
N5O80_RS22755 4660380..4660487 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O80_RS22760 4660863..4660970 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O80_RS22765 4661346..4661453 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O80_RS22770 4661929..4663200 + 1272 WP_001318103.1 aromatic amino acid transport family protein -
N5O80_RS22775 4663230..4664234 - 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4659214..4659672 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T258286 WP_001295224.1 NZ_CP104523:c4660004-4659897 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT258286 NZ_CP104523:4660061-4660119 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References