Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4244936..4245735 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | N5O80_RS20675 | Protein ID | WP_000347251.1 |
Coordinates | 4245271..4245735 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | N5O80_RS20670 | Protein ID | WP_001296435.1 |
Coordinates | 4244936..4245271 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS20655 (4240721) | 4240721..4241491 | - | 771 | WP_261306712.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N5O80_RS20660 (4241507) | 4241507..4242841 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5O80_RS20665 (4243216) | 4243216..4244787 | + | 1572 | WP_001273941.1 | galactarate dehydratase | - |
N5O80_RS20670 (4244936) | 4244936..4245271 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5O80_RS20675 (4245271) | 4245271..4245735 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5O80_RS20680 (4245790) | 4245790..4246599 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N5O80_RS20685 (4246848) | 4246848..4248128 | + | 1281 | WP_000681938.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5O80_RS20690 (4248151) | 4248151..4248624 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5O80_RS20695 (4248635) | 4248635..4249414 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5O80_RS20700 (4249404) | 4249404..4250282 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5O80_RS20705 (4250300) | 4250300..4250734 | + | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4237240..4245735 | 8495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T258283 WP_000347251.1 NZ_CP104523:4245271-4245735 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |