Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2124743..2125114 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A1Y2ZGM7 |
| Locus tag | N5O80_RS10360 | Protein ID | WP_042038331.1 |
| Coordinates | 2124920..2125114 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2124743..2124921 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS10330 (2120495) | 2120495..2120668 | + | 174 | WP_001296046.1 | protein YnaL | - |
| N5O80_RS10335 (2120698) | 2120698..2122071 | + | 1374 | WP_001272254.1 | ATP-dependent RNA helicase DbpA | - |
| N5O80_RS10340 (2122200) | 2122200..2123135 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| N5O80_RS10345 (2123187) | 2123187..2124422 | - | 1236 | WP_000040851.1 | site-specific integrase | - |
| N5O80_RS10350 (2124424) | 2124424..2124639 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2124743) | 2124743..2124921 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2124743) | 2124743..2124921 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2124743) | 2124743..2124921 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2124743) | 2124743..2124921 | + | 179 | NuclAT_0 | - | Antitoxin |
| N5O80_RS10355 (2124739) | 2124739..2124927 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| N5O80_RS10360 (2124920) | 2124920..2125114 | - | 195 | WP_042038331.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| N5O80_RS10365 (2125171) | 2125171..2125980 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| N5O80_RS10370 (2125973) | 2125973..2128573 | - | 2601 | WP_000105139.1 | exodeoxyribonuclease VIII | - |
| N5O80_RS10375 (2128675) | 2128675..2128950 | - | 276 | WP_000632297.1 | protein RacC | - |
| N5O80_RS10380 (2129025) | 2129025..2129195 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| N5O80_RS10385 (2129195) | 2129195..2129416 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2123187..2170944 | 47757 | |
| - | inside | Prophage | sitABCD | - | 2123187..2189046 | 65859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.94 Da Isoelectric Point: 8.9538
>T258270 WP_042038331.1 NZ_CP104523:c2125114-2124920 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKVISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKVISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT258270 NZ_CP104523:2124743-2124921 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
