Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1233497..1234176 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | N5O80_RS05830 | Protein ID | WP_000057523.1 |
Coordinates | 1233497..1233799 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | N5O80_RS05835 | Protein ID | WP_000806442.1 |
Coordinates | 1233835..1234176 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS05810 (1228828) | 1228828..1230048 | - | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
N5O80_RS05815 (1230266) | 1230266..1231850 | + | 1585 | Protein_1133 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
N5O80_RS05820 (1231887) | 1231887..1232366 | - | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
N5O80_RS05825 (1232570) | 1232570..1233364 | - | 795 | WP_000365161.1 | TraB/GumN family protein | - |
N5O80_RS05830 (1233497) | 1233497..1233799 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O80_RS05835 (1233835) | 1233835..1234176 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
N5O80_RS05840 (1234234) | 1234234..1236738 | - | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
N5O80_RS05845 (1237001) | 1237001..1237933 | + | 933 | WP_261306735.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1233497..1243580 | 10083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T258267 WP_000057523.1 NZ_CP104523:1233497-1233799 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|