Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4932486..4933088 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N5O78_RS23870 | Protein ID | WP_000897305.1 |
Coordinates | 4932486..4932797 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5O78_RS23875 | Protein ID | WP_000356397.1 |
Coordinates | 4932798..4933088 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS23845 (4928400) | 4928400..4928999 | + | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
N5O78_RS23850 (4928993) | 4928993..4929865 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N5O78_RS23855 (4929862) | 4929862..4930299 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N5O78_RS23860 (4930344) | 4930344..4931285 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N5O78_RS23865 (4931349) | 4931349..4932257 | - | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
N5O78_RS23870 (4932486) | 4932486..4932797 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N5O78_RS23875 (4932798) | 4932798..4933088 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N5O78_RS23880 (4933693) | 4933693..4933911 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N5O78_RS23885 (4934126) | 4934126..4935055 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
N5O78_RS23890 (4935052) | 4935052..4935687 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5O78_RS23895 (4935684) | 4935684..4936586 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258260 WP_000897305.1 NZ_CP104521:4932486-4932797 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|