Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4526162..4526384 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | N5O78_RS21955 | Protein ID | WP_000170738.1 |
| Coordinates | 4526162..4526269 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4526318..4526384 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS21925 | 4521191..4522762 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| N5O78_RS21930 | 4522759..4522950 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| N5O78_RS21935 | 4522947..4524626 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| N5O78_RS21940 | 4524713..4524820 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O78_RS21945 | 4525196..4525303 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O78_RS21950 | 4525679..4525786 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| N5O78_RS21955 | 4526162..4526269 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4526318..4526384 | + | 67 | - | - | Antitoxin |
| N5O78_RS21960 | 4526745..4528016 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| N5O78_RS21965 | 4528046..4529050 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| N5O78_RS21970 | 4529047..4530030 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| N5O78_RS21975 | 4530041..4530943 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T258259 WP_000170738.1 NZ_CP104521:c4526269-4526162 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT258259 NZ_CP104521:4526318-4526384 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|