Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4524713..4524935 Replicon chromosome
Accession NZ_CP104521
Organism Escherichia coli strain E5

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag N5O78_RS21940 Protein ID WP_001295224.1
Coordinates 4524713..4524820 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4524877..4524935 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O78_RS21915 4519966..4520718 - 753 WP_000279544.1 cellulose biosynthesis protein BcsQ -
N5O78_RS21920 4520730..4520918 - 189 WP_001063315.1 cellulose biosynthesis protein BcsR -
N5O78_RS21925 4521191..4522762 + 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
N5O78_RS21930 4522759..4522950 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
N5O78_RS21935 4522947..4524626 + 1680 WP_001562264.1 cellulose biosynthesis protein BcsG -
N5O78_RS21940 4524713..4524820 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4524877..4524935 + 59 - - Antitoxin
N5O78_RS21945 4525196..4525303 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O78_RS21950 4525679..4525786 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O78_RS21955 4526162..4526269 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
N5O78_RS21960 4526745..4528016 + 1272 WP_001318103.1 aromatic amino acid transport family protein -
N5O78_RS21965 4528046..4529050 - 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T258257 WP_001295224.1 NZ_CP104521:c4524820-4524713 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT258257 NZ_CP104521:4524877-4524935 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References