Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4075919..4076718 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | N5O78_RS19725 | Protein ID | WP_000347251.1 |
| Coordinates | 4076254..4076718 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | N5O78_RS19720 | Protein ID | WP_001296435.1 |
| Coordinates | 4075919..4076254 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS19705 (4071704) | 4071704..4072474 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N5O78_RS19710 (4072490) | 4072490..4073824 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5O78_RS19715 (4074199) | 4074199..4075770 | + | 1572 | WP_094122420.1 | galactarate dehydratase | - |
| N5O78_RS19720 (4075919) | 4075919..4076254 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5O78_RS19725 (4076254) | 4076254..4076718 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5O78_RS19730 (4076773) | 4076773..4077582 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5O78_RS19735 (4077831) | 4077831..4079111 | + | 1281 | WP_000681938.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5O78_RS19740 (4079134) | 4079134..4079607 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5O78_RS19745 (4079618) | 4079618..4080397 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5O78_RS19750 (4080387) | 4080387..4081265 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5O78_RS19755 (4081283) | 4081283..4081717 | + | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T258254 WP_000347251.1 NZ_CP104521:4076254-4076718 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |