Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1172971..1173650 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | N5O78_RS05530 | Protein ID | WP_000057523.1 |
Coordinates | 1172971..1173273 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | N5O78_RS05535 | Protein ID | WP_000806442.1 |
Coordinates | 1173309..1173650 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS05510 (1168243) | 1168243..1169463 | - | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
N5O78_RS05515 (1169681) | 1169681..1171324 | + | 1644 | WP_094122321.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
N5O78_RS05520 (1171361) | 1171361..1171840 | - | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
N5O78_RS05525 (1172044) | 1172044..1172838 | - | 795 | WP_000365161.1 | TraB/GumN family protein | - |
N5O78_RS05530 (1172971) | 1172971..1173273 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O78_RS05535 (1173309) | 1173309..1173650 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
N5O78_RS05540 (1173708) | 1173708..1176212 | - | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
N5O78_RS05545 (1176475) | 1176475..1177407 | + | 933 | WP_000883024.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1172971..1183054 | 10083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T258241 WP_000057523.1 NZ_CP104521:1172971-1173273 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|