Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3956926..3957619 | Replicon | chromosome |
| Accession | NZ_CP104516 | ||
| Organism | Escherichia coli strain E4 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | N5O79_RS19750 | Protein ID | WP_000415584.1 |
| Coordinates | 3956926..3957222 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | N5O79_RS19755 | Protein ID | WP_000650107.1 |
| Coordinates | 3957224..3957619 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O79_RS19715 (3952014) | 3952014..3952328 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| N5O79_RS19720 (3952359) | 3952359..3952940 | - | 582 | Protein_3853 | NADPH:quinone oxidoreductase MdaB | - |
| N5O79_RS19725 (3953259) | 3953259..3953591 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| N5O79_RS19730 (3953637) | 3953637..3954986 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| N5O79_RS19735 (3954983) | 3954983..3955642 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| N5O79_RS19740 (3955794) | 3955794..3956186 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| N5O79_RS19745 (3956239) | 3956239..3956721 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| N5O79_RS19750 (3956926) | 3956926..3957222 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| N5O79_RS19755 (3957224) | 3957224..3957619 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| N5O79_RS19760 (3957752) | 3957752..3959359 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| N5O79_RS19765 (3959497) | 3959497..3961755 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T258229 WP_000415584.1 NZ_CP104516:3956926-3957222 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT258229 WP_000650107.1 NZ_CP104516:3957224-3957619 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|