Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3892352..3893079 | Replicon | chromosome |
| Accession | NZ_CP104516 | ||
| Organism | Escherichia coli strain E4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | N5O79_RS19445 | Protein ID | WP_000550189.1 |
| Coordinates | 3892352..3892666 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5O79_RS19450 | Protein ID | WP_000560266.1 |
| Coordinates | 3892663..3893079 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O79_RS19425 (3888510) | 3888510..3889496 | - | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
| N5O79_RS19430 (3889575) | 3889575..3890267 | - | 693 | WP_000942546.1 | vancomycin high temperature exclusion protein | - |
| N5O79_RS19435 (3890344) | 3890344..3890847 | - | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
| N5O79_RS19440 (3890932) | 3890932..3892068 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| N5O79_RS19445 (3892352) | 3892352..3892666 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| N5O79_RS19450 (3892663) | 3892663..3893079 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| N5O79_RS19455 (3893124) | 3893124..3895142 | - | 2019 | WP_000121449.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| N5O79_RS19460 (3895568) | 3895568..3897919 | - | 2352 | WP_261307014.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T258228 WP_000550189.1 NZ_CP104516:3892352-3892666 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT258228 WP_000560266.1 NZ_CP104516:3892663-3893079 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|