Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2057521..2058215 | Replicon | chromosome |
| Accession | NZ_CP104516 | ||
| Organism | Escherichia coli strain E4 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | N5O79_RS10545 | Protein ID | WP_001263493.1 |
| Coordinates | 2057521..2057919 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N5O79_RS10550 | Protein ID | WP_000554757.1 |
| Coordinates | 2057922..2058215 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (2053181) | 2053181..2053261 | - | 81 | NuclAT_13 | - | - |
| - (2053181) | 2053181..2053261 | - | 81 | NuclAT_13 | - | - |
| - (2053181) | 2053181..2053261 | - | 81 | NuclAT_13 | - | - |
| - (2053181) | 2053181..2053261 | - | 81 | NuclAT_13 | - | - |
| N5O79_RS10515 (2052521) | 2052521..2053765 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| N5O79_RS10520 (2053857) | 2053857..2054315 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N5O79_RS10525 (2054576) | 2054576..2056033 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| N5O79_RS10530 (2056090) | 2056090..2056611 | - | 522 | Protein_2070 | peptide chain release factor H | - |
| N5O79_RS10535 (2056610) | 2056610..2056813 | - | 204 | Protein_2071 | RtcB family protein | - |
| N5O79_RS10540 (2057059) | 2057059..2057511 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| N5O79_RS10545 (2057521) | 2057521..2057919 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5O79_RS10550 (2057922) | 2057922..2058215 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5O79_RS10555 (2058267) | 2058267..2059322 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N5O79_RS10560 (2059393) | 2059393..2060178 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5O79_RS10565 (2060150) | 2060150..2061862 | + | 1713 | Protein_2077 | flagellar biosynthesis protein FlhA | - |
| N5O79_RS10570 (2062078) | 2062078..2062575 | - | 498 | WP_000006260.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T258222 WP_001263493.1 NZ_CP104516:c2057919-2057521 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|