Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 39433..39697 Replicon plasmid p3
Accession NZ_CP104512
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag N5O74_RS27345 Protein ID WP_001331364.1
Coordinates 39545..39697 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 39433..39490 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O74_RS27330 (35771) 35771..36841 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
N5O74_RS27335 (36860) 36860..38068 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
N5O74_RS27340 (38286) 38286..39239 - 954 WP_021513958.1 hypothetical protein -
- (39433) 39433..39490 - 58 NuclAT_0 - Antitoxin
- (39433) 39433..39490 - 58 NuclAT_0 - Antitoxin
- (39433) 39433..39490 - 58 NuclAT_0 - Antitoxin
- (39433) 39433..39490 - 58 NuclAT_0 - Antitoxin
N5O74_RS27345 (39545) 39545..39697 + 153 WP_001331364.1 Hok/Gef family protein Toxin
N5O74_RS27350 (39769) 39769..40020 - 252 WP_001291964.1 hypothetical protein -
N5O74_RS27355 (40382) 40382..40614 + 233 Protein_51 hypothetical protein -
N5O74_RS27360 (40679) 40679..40855 - 177 WP_001054900.1 hypothetical protein -
N5O74_RS27365 (41187) 41187..41396 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
N5O74_RS27370 (41468) 41468..42130 - 663 WP_000644792.1 plasmid IncI1-type surface exclusion protein ExcA -
N5O74_RS27375 (42195) 42195..44363 - 2169 WP_000698366.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..83246 83246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T258209 WP_001331364.1 NZ_CP104512:39545-39697 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT258209 NZ_CP104512:c39490-39433 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References