Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4195291..4195984 | Replicon | chromosome |
Accession | NZ_CP104509 | ||
Organism | Escherichia coli strain E2 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N5O74_RS21255 | Protein ID | WP_000415584.1 |
Coordinates | 4195688..4195984 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N5O74_RS21250 | Protein ID | WP_000650107.1 |
Coordinates | 4195291..4195686 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O74_RS21240 (4191155) | 4191155..4193413 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
N5O74_RS21245 (4193551) | 4193551..4195158 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
N5O74_RS21250 (4195291) | 4195291..4195686 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N5O74_RS21255 (4195688) | 4195688..4195984 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N5O74_RS21260 (4196189) | 4196189..4196614 | - | 426 | WP_222890937.1 | GyrI-like domain-containing protein | - |
N5O74_RS21265 (4196672) | 4196672..4197880 | - | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
N5O74_RS21270 (4198062) | 4198062..4198454 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N5O74_RS21275 (4198606) | 4198606..4199265 | + | 660 | WP_001221487.1 | quorum sensing response regulator transcription factor QseB | - |
N5O74_RS21280 (4199262) | 4199262..4200611 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4196672..4197880 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T258202 WP_000415584.1 NZ_CP104509:c4195984-4195688 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT258202 WP_000650107.1 NZ_CP104509:c4195686-4195291 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|