Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 956677..957371 | Replicon | chromosome |
| Accession | NZ_CP104509 | ||
| Organism | Escherichia coli strain E2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | N5O74_RS04850 | Protein ID | WP_001263489.1 |
| Coordinates | 956973..957371 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | N5O74_RS04845 | Protein ID | WP_000554758.1 |
| Coordinates | 956677..956970 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O74_RS04825 (952309) | 952309..952806 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| N5O74_RS04830 (953030) | 953030..954742 | - | 1713 | Protein_935 | flagellar biosynthesis protein FlhA | - |
| N5O74_RS04835 (954714) | 954714..955499 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5O74_RS04840 (955570) | 955570..956625 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N5O74_RS04845 (956677) | 956677..956970 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5O74_RS04850 (956973) | 956973..957371 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5O74_RS04855 (957381) | 957381..957833 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| N5O74_RS04860 (958151) | 958151..958357 | + | 207 | Protein_941 | RtcB family protein | - |
| N5O74_RS04865 (958353) | 958353..958874 | + | 522 | Protein_942 | peptide chain release factor H | - |
| N5O74_RS04870 (958931) | 958931..960388 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| N5O74_RS04875 (960649) | 960649..961107 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (961703) | 961703..961783 | + | 81 | NuclAT_12 | - | - |
| - (961703) | 961703..961783 | + | 81 | NuclAT_12 | - | - |
| - (961703) | 961703..961783 | + | 81 | NuclAT_12 | - | - |
| - (961703) | 961703..961783 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | hcp1/tssD1 / tssA / rhs/PAAR / gmhA/lpcA | 929163..958874 | 29711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T258188 WP_001263489.1 NZ_CP104509:956973-957371 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |