Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 956677..957371 Replicon chromosome
Accession NZ_CP104509
Organism Escherichia coli strain E2

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag N5O74_RS04850 Protein ID WP_001263489.1
Coordinates 956973..957371 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag N5O74_RS04845 Protein ID WP_000554758.1
Coordinates 956677..956970 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O74_RS04825 (952309) 952309..952806 + 498 WP_000006255.1 REP-associated tyrosine transposase RayT -
N5O74_RS04830 (953030) 953030..954742 - 1713 Protein_935 flagellar biosynthesis protein FlhA -
N5O74_RS04835 (954714) 954714..955499 + 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
N5O74_RS04840 (955570) 955570..956625 + 1056 WP_001226164.1 DNA polymerase IV -
N5O74_RS04845 (956677) 956677..956970 + 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
N5O74_RS04850 (956973) 956973..957371 + 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
N5O74_RS04855 (957381) 957381..957833 + 453 WP_001059892.1 GNAT family N-acetyltransferase -
N5O74_RS04860 (958151) 958151..958357 + 207 Protein_941 RtcB family protein -
N5O74_RS04865 (958353) 958353..958874 + 522 Protein_942 peptide chain release factor H -
N5O74_RS04870 (958931) 958931..960388 - 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
N5O74_RS04875 (960649) 960649..961107 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (961703) 961703..961783 + 81 NuclAT_12 - -
- (961703) 961703..961783 + 81 NuclAT_12 - -
- (961703) 961703..961783 + 81 NuclAT_12 - -
- (961703) 961703..961783 + 81 NuclAT_12 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - hcp1/tssD1 / tssA / rhs/PAAR / gmhA/lpcA 929163..958874 29711


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T258188 WP_001263489.1 NZ_CP104509:956973-957371 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT258188 WP_000554758.1 NZ_CP104509:956677-956970 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References