Detailed information of TA system TA258179

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 362484..362910
• Replicon: plasmid p1
• Accession: NZ_CP104504
• Organism: Escherichia coli strain E1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N5O81_RS25730
• Protein ID: WP_001372321.1
• Coordinates: 362484..362609 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	362686..362910 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N5O81_RS25685 (357534)	357534..357761	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
N5O81_RS25690 (357855)	357855..358541	-	687	WP_000332492.1	PAS domain-containing protein	-
N5O81_RS25695 (358731)	358731..359114	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N5O81_RS25700 (359436)	359436..360038	+	603	WP_072156291.1	transglycosylase SLT domain-containing protein	-
N5O81_RS25705 (360335)	360335..361156	-	822	WP_001234469.1	DUF932 domain-containing protein	-
N5O81_RS25710 (361275)	361275..361562	-	288	WP_000107535.1	hypothetical protein	-
N5O81_RS25715 (361587)	361587..361793	-	207	WP_000547968.1	hypothetical protein	-
N5O81_RS25720 (361863)	361863..362036	+	174	Protein_376	hypothetical protein	-
N5O81_RS25725 (362034)	362034..362264	-	231	WP_077688699.1	hypothetical protein	-
N5O81_RS25730 (362484)	362484..362609	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N5O81_RS25735 (362551)	362551..362700	-	150	Protein_379	plasmid maintenance protein Mok	-
- (362686)	362686..362910	-	225	NuclAT_0	-	Antitoxin
- (362686)	362686..362910	-	225	NuclAT_0	-	Antitoxin
- (362686)	362686..362910	-	225	NuclAT_0	-	Antitoxin
- (362686)	362686..362910	-	225	NuclAT_0	-	Antitoxin
N5O81_RS25740 (362722)	362722..362910	+	189	WP_001299721.1	hypothetical protein	-
N5O81_RS25745 (362879)	362879..363641	-	763	Protein_381	plasmid SOS inhibition protein A	-
N5O81_RS25750 (363638)	363638..364072	-	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
N5O81_RS25755 (364127)	364127..366085	-	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
N5O81_RS25760 (366150)	366150..366383	-	234	WP_000006030.1	DUF905 family protein	-
N5O81_RS25765 (366445)	366445..366984	-	540	WP_000290812.1	single-stranded DNA-binding protein	-
N5O81_RS25770 (367010)	367010..367216	-	207	WP_000547971.1	hypothetical protein	-
N5O81_RS25775 (367457)	367457..367684	-	228	WP_071594011.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / aph(6)-Id / aph(3'')-Ib / aac(3)-IVa / aph(4)-Ia / sitABCD	iroB / iroC / iroD / iroE / iroN	1..390109	390109

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T258179 WP_001372321.1 NZ_CP104504:c362609-362484 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT258179 NZ_CP104504:c362910-362686 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin