Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4243134..4243828 | Replicon | chromosome |
| Accession | NZ_CP104503 | ||
| Organism | Escherichia coli strain E1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | B7MQ69 |
| Locus tag | N5O81_RS20525 | Protein ID | WP_001263501.1 |
| Coordinates | 4243430..4243828 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | N5O81_RS20520 | Protein ID | WP_000554755.1 |
| Coordinates | 4243134..4243427 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O81_RS20495 (4238473) | 4238473..4238970 | + | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
| N5O81_RS20500 (4238965) | 4238965..4239459 | - | 495 | WP_139174989.1 | hypothetical protein | - |
| N5O81_RS20505 (4239487) | 4239487..4241199 | - | 1713 | Protein_4007 | flagellar biosynthesis protein FlhA | - |
| N5O81_RS20510 (4241171) | 4241171..4241956 | + | 786 | WP_000207543.1 | putative lateral flagellar export/assembly protein LafU | - |
| N5O81_RS20515 (4242027) | 4242027..4243082 | + | 1056 | WP_001226170.1 | DNA polymerase IV | - |
| N5O81_RS20520 (4243134) | 4243134..4243427 | + | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N5O81_RS20525 (4243430) | 4243430..4243828 | + | 399 | WP_001263501.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N5O81_RS20530 (4243838) | 4243838..4244290 | + | 453 | WP_001059897.1 | GNAT family N-acetyltransferase | - |
| N5O81_RS20535 (4244480) | 4244480..4245619 | + | 1140 | WP_000521578.1 | RNA ligase RtcB family protein | - |
| N5O81_RS20540 (4245616) | 4245616..4246230 | + | 615 | WP_000602123.1 | peptide chain release factor H | - |
| N5O81_RS20545 (4246287) | 4246287..4247744 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| N5O81_RS20550 (4248005) | 4248005..4248463 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0950
>T258175 WP_001263501.1 NZ_CP104503:4243430-4243828 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376DBU4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |