Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3972774..3973032 | Replicon | chromosome |
Accession | NZ_CP104503 | ||
Organism | Escherichia coli strain E1 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | N5O81_RS19270 | Protein ID | WP_000809168.1 |
Coordinates | 3972774..3972926 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3972975..3973032 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O81_RS19250 | 3968019..3968732 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
N5O81_RS19255 | 3968758..3969162 | - | 405 | WP_000843692.1 | DUF2541 family protein | - |
N5O81_RS19260 | 3969534..3971450 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
N5O81_RS19265 | 3971539..3972669 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
N5O81_RS19270 | 3972774..3972926 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3972975..3973032 | + | 58 | - | - | Antitoxin |
N5O81_RS19275 | 3973541..3974302 | + | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
N5O81_RS19280 | 3974322..3975815 | + | 1494 | WP_001350365.1 | sulfatase-like hydrolase/transferase | - |
N5O81_RS19285 | 3975944..3977203 | + | 1260 | WP_000494929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T258173 WP_000809168.1 NZ_CP104503:c3972926-3972774 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT258173 NZ_CP104503:3972975-3973032 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|