Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3298264..3298866 | Replicon | chromosome |
Accession | NZ_CP104503 | ||
Organism | Escherichia coli strain E1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | N5O81_RS15995 | Protein ID | WP_000897302.1 |
Coordinates | 3298264..3298575 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5O81_RS16000 | Protein ID | WP_000356397.1 |
Coordinates | 3298576..3298866 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O81_RS15970 (3294178) | 3294178..3294777 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
N5O81_RS15975 (3294771) | 3294771..3295643 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N5O81_RS15980 (3295640) | 3295640..3296077 | + | 438 | WP_000560990.1 | D-aminoacyl-tRNA deacylase | - |
N5O81_RS15985 (3296122) | 3296122..3297063 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N5O81_RS15990 (3297127) | 3297127..3298035 | - | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
N5O81_RS15995 (3298264) | 3298264..3298575 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
N5O81_RS16000 (3298576) | 3298576..3298866 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N5O81_RS16005 (3299225) | 3299225..3299503 | + | 279 | WP_001296612.1 | hypothetical protein | - |
N5O81_RS16010 (3299899) | 3299899..3300117 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
N5O81_RS16015 (3300333) | 3300333..3301262 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
N5O81_RS16020 (3301259) | 3301259..3301894 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N5O81_RS16025 (3301891) | 3301891..3302793 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T258170 WP_000897302.1 NZ_CP104503:3298264-3298575 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|