Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2484438..2485237 | Replicon | chromosome |
| Accession | NZ_CP104503 | ||
| Organism | Escherichia coli strain E1 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | N5O81_RS12030 | Protein ID | WP_000347251.1 |
| Coordinates | 2484773..2485237 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | N5O81_RS12025 | Protein ID | WP_001296435.1 |
| Coordinates | 2484438..2484773 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O81_RS12010 (2480223) | 2480223..2480993 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N5O81_RS12015 (2481009) | 2481009..2482343 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5O81_RS12020 (2482718) | 2482718..2484289 | + | 1572 | WP_001273939.1 | galactarate dehydratase | - |
| N5O81_RS12025 (2484438) | 2484438..2484773 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5O81_RS12030 (2484773) | 2484773..2485237 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5O81_RS12035 (2485292) | 2485292..2486101 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5O81_RS12040 (2486350) | 2486350..2487630 | + | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5O81_RS12045 (2487653) | 2487653..2488126 | + | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5O81_RS12050 (2488137) | 2488137..2488916 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5O81_RS12055 (2488906) | 2488906..2489784 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5O81_RS12060 (2489802) | 2489802..2490236 | + | 435 | WP_000948834.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T258169 WP_000347251.1 NZ_CP104503:2484773-2485237 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |