Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4920731..4921333 | Replicon | chromosome |
| Accession | NZ_CP104500 | ||
| Organism | Escherichia coli strain E9 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | N5O75_RS24255 | Protein ID | WP_000897305.1 |
| Coordinates | 4921022..4921333 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5O75_RS24250 | Protein ID | WP_000356397.1 |
| Coordinates | 4920731..4921021 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O75_RS24225 (4916657) | 4916657..4917559 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N5O75_RS24230 (4917556) | 4917556..4918191 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5O75_RS24235 (4918188) | 4918188..4919117 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| N5O75_RS24240 (4919447) | 4919447..4919689 | - | 243 | WP_001086388.1 | protein YiiF | - |
| N5O75_RS24245 (4919908) | 4919908..4920126 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| N5O75_RS24250 (4920731) | 4920731..4921021 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N5O75_RS24255 (4921022) | 4921022..4921333 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| N5O75_RS24260 (4921562) | 4921562..4922470 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| N5O75_RS24265 (4922534) | 4922534..4923475 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N5O75_RS24270 (4923520) | 4923520..4923957 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| N5O75_RS24275 (4923954) | 4923954..4924826 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N5O75_RS24280 (4924820) | 4924820..4925419 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258153 WP_000897305.1 NZ_CP104500:c4921333-4921022 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|