Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 644182..644981 | Replicon | chromosome |
Accession | NZ_CP104500 | ||
Organism | Escherichia coli strain E9 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | N5O75_RS03160 | Protein ID | WP_000347267.1 |
Coordinates | 644182..644646 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N5O75_RS03165 | Protein ID | WP_001307405.1 |
Coordinates | 644646..644981 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O75_RS03130 (639183) | 639183..639617 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N5O75_RS03135 (639635) | 639635..640513 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N5O75_RS03140 (640503) | 640503..641282 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N5O75_RS03145 (641293) | 641293..641766 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N5O75_RS03150 (641789) | 641789..643069 | - | 1281 | WP_000681947.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N5O75_RS03155 (643318) | 643318..644127 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
N5O75_RS03160 (644182) | 644182..644646 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N5O75_RS03165 (644646) | 644646..644981 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N5O75_RS03170 (645130) | 645130..646701 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
N5O75_RS03175 (647076) | 647076..648410 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N5O75_RS03180 (648426) | 648426..649196 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T258134 WP_000347267.1 NZ_CP104500:c644646-644182 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |