Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4770884..4771638 | Replicon | chromosome |
| Accession | NZ_CP104491 | ||
| Organism | Salmonella enterica strain SalSpp_sample_05_No.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | N4229_RS23330 | Protein ID | WP_000558166.1 |
| Coordinates | 4770884..4771195 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4229_RS23335 | Protein ID | WP_001259011.1 |
| Coordinates | 4771192..4771638 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4229_RS23300 (4766542) | 4766542..4767444 | + | 903 | WP_000331362.1 | formate dehydrogenase subunit beta | - |
| N4229_RS23305 (4767441) | 4767441..4768076 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4229_RS23310 (4768073) | 4768073..4769002 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4229_RS23315 (4769049) | 4769049..4769339 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4229_RS23320 (4769340) | 4769340..4769651 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4229_RS23325 (4769869) | 4769869..4770798 | + | 930 | WP_057935376.1 | alpha/beta hydrolase | - |
| N4229_RS23330 (4770884) | 4770884..4771195 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4229_RS23335 (4771192) | 4771192..4771638 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4229_RS23340 (4771653) | 4771653..4772594 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4229_RS23345 (4772639) | 4772639..4773076 | - | 438 | WP_050068031.1 | D-aminoacyl-tRNA deacylase | - |
| N4229_RS23350 (4773073) | 4773073..4773945 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N4229_RS23355 (4773939) | 4773939..4774538 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| N4229_RS23360 (4774729) | 4774729..4775532 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4229_RS23365 (4775566) | 4775566..4776462 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T258124 WP_000558166.1 NZ_CP104491:4770884-4771195 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT258124 WP_001259011.1 NZ_CP104491:4771192-4771638 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|