Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2757158..2757885 | Replicon | chromosome |
| Accession | NZ_CP104491 | ||
| Organism | Salmonella enterica strain SalSpp_sample_05_No.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V7IQW2 |
| Locus tag | N4229_RS13580 | Protein ID | WP_000558158.1 |
| Coordinates | 2757158..2757469 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4229_RS13585 | Protein ID | WP_000561389.1 |
| Coordinates | 2757466..2757885 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4229_RS13545 (2752339) | 2752339..2753061 | - | 723 | WP_023223000.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| N4229_RS13550 (2753748) | 2753748..2754143 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| N4229_RS13555 (2754472) | 2754472..2754948 | + | 477 | WP_050067668.1 | hypothetical protein | - |
| N4229_RS13560 (2755069) | 2755069..2755236 | + | 168 | WP_157720731.1 | hypothetical protein | - |
| N4229_RS13565 (2755599) | 2755599..2756381 | + | 783 | WP_232472616.1 | DUF2971 domain-containing protein | - |
| N4229_RS13570 (2756435) | 2756435..2756650 | - | 216 | WP_071975290.1 | hypothetical protein | - |
| N4229_RS13575 (2756680) | 2756680..2756979 | - | 300 | WP_050067669.1 | hypothetical protein | - |
| N4229_RS13580 (2757158) | 2757158..2757469 | + | 312 | WP_000558158.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4229_RS13585 (2757466) | 2757466..2757885 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N4229_RS13590 (2758132) | 2758132..2758791 | + | 660 | Protein_2665 | glycosyltransferase | - |
| N4229_RS13595 (2759027) | 2759027..2759446 | - | 420 | WP_050067670.1 | GNAT family N-acetyltransferase | - |
| N4229_RS13600 (2759816) | 2759816..2760085 | + | 270 | WP_077942236.1 | hypothetical protein | - |
| N4229_RS13605 (2760251) | 2760251..2760391 | + | 141 | WP_045899713.1 | hypothetical protein | - |
| N4229_RS13610 (2760534) | 2760534..2761079 | - | 546 | Protein_2669 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2760534..2761214 | 680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.19 Da Isoelectric Point: 10.0279
>T258115 WP_000558158.1 NZ_CP104491:2757158-2757469 [Salmonella enterica]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRTVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT258115 WP_000561389.1 NZ_CP104491:2757466-2757885 [Salmonella enterica]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|