Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1931469..1932129 | Replicon | chromosome |
| Accession | NZ_CP104491 | ||
| Organism | Salmonella enterica strain SalSpp_sample_05_No.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N4229_RS09280 | Protein ID | WP_057935533.1 |
| Coordinates | 1931469..1931822 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4229_RS09285 | Protein ID | WP_057935532.1 |
| Coordinates | 1931827..1932129 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4229_RS09260 (1926532) | 1926532..1927467 | - | 936 | WP_050067699.1 | hypothetical protein | - |
| N4229_RS09265 (1927471) | 1927471..1929525 | - | 2055 | WP_057935534.1 | RHS repeat-associated core domain-containing protein | - |
| N4229_RS09270 (1929598) | 1929598..1929825 | + | 228 | Protein_1816 | integrase core domain-containing protein | - |
| N4229_RS09275 (1930451) | 1930451..1931006 | - | 556 | Protein_1817 | IS630 family transposase | - |
| N4229_RS09280 (1931469) | 1931469..1931822 | + | 354 | WP_057935533.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4229_RS09285 (1931827) | 1931827..1932129 | + | 303 | WP_057935532.1 | XRE family transcriptional regulator | Antitoxin |
| N4229_RS09290 (1932635) | 1932635..1933521 | + | 887 | Protein_1820 | integrase domain-containing protein | - |
| N4229_RS09295 (1934005) | 1934005..1935267 | - | 1263 | WP_050067692.1 | integrase arm-type DNA-binding domain-containing protein | - |
| N4229_RS09305 (1935664) | 1935664..1937121 | + | 1458 | WP_001670524.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13512.35 Da Isoelectric Point: 9.4804
>T258113 WP_057935533.1 NZ_CP104491:1931469-1931822 [Salmonella enterica]
VWTIKTTDTFDNWFTSLNDTDRANVLAALLVLREKGPGLSRPYADTIRGSRYSNMKELRIQSRGYPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDNWFTSLNDTDRANVLAALLVLREKGPGLSRPYADTIRGSRYSNMKELRIQSRGYPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|