Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4613386..4614140 | Replicon | chromosome |
| Accession | NZ_CP104488 | ||
| Organism | Salmonella enterica strain SalSpp_sample_10_No.2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | N4232_RS22630 | Protein ID | WP_000558166.1 |
| Coordinates | 4613386..4613697 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4232_RS22635 | Protein ID | WP_001259009.1 |
| Coordinates | 4613694..4614140 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4232_RS22600 (4609044) | 4609044..4609946 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| N4232_RS22605 (4609943) | 4609943..4610578 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4232_RS22610 (4610575) | 4610575..4611504 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4232_RS22615 (4611551) | 4611551..4611841 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4232_RS22620 (4611842) | 4611842..4612153 | - | 312 | WP_001159631.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4232_RS22625 (4612371) | 4612371..4613300 | + | 930 | WP_001127691.1 | alpha/beta hydrolase | - |
| N4232_RS22630 (4613386) | 4613386..4613697 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4232_RS22635 (4613694) | 4613694..4614140 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4232_RS22640 (4614155) | 4614155..4615096 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4232_RS22645 (4615141) | 4615141..4615578 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| N4232_RS22650 (4615575) | 4615575..4616447 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N4232_RS22655 (4616441) | 4616441..4617040 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N4232_RS22660 (4617231) | 4617231..4618034 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4232_RS22665 (4618068) | 4618068..4618964 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T258108 WP_000558166.1 NZ_CP104488:4613386-4613697 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT258108 WP_001259009.1 NZ_CP104488:4613694-4614140 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|