Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4772538..4773140 | Replicon | chromosome |
| Accession | NZ_CP104484 | ||
| Organism | Salmonella enterica strain SalSpp_sample_07_No.3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | N4231_RS23360 | Protein ID | WP_001159630.1 |
| Coordinates | 4772829..4773140 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4231_RS23355 | Protein ID | WP_000362050.1 |
| Coordinates | 4772538..4772828 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4231_RS23340 (4770031) | 4770031..4770933 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| N4231_RS23345 (4770930) | 4770930..4771565 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4231_RS23350 (4771562) | 4771562..4772491 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4231_RS23355 (4772538) | 4772538..4772828 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| N4231_RS23360 (4772829) | 4772829..4773140 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| N4231_RS23365 (4773358) | 4773358..4774287 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| N4231_RS23370 (4774373) | 4774373..4774684 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| N4231_RS23375 (4774681) | 4774681..4775127 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| N4231_RS23380 (4775142) | 4775142..4776083 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4231_RS23385 (4776128) | 4776128..4776565 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| N4231_RS23390 (4776562) | 4776562..4777434 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| N4231_RS23395 (4777428) | 4777428..4778027 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T258090 WP_001159630.1 NZ_CP104484:c4773140-4772829 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|