Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2441789..2442311 | Replicon | chromosome |
Accession | NZ_CP104484 | ||
Organism | Salmonella enterica strain SalSpp_sample_07_No.3 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | N4231_RS11980 | Protein ID | WP_000221343.1 |
Coordinates | 2442027..2442311 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | N4231_RS11975 | Protein ID | WP_000885424.1 |
Coordinates | 2441789..2442037 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4231_RS11950 (2437005) | 2437005..2438471 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
N4231_RS11955 (2439279) | 2439279..2439993 | + | 715 | Protein_2339 | helix-turn-helix domain-containing protein | - |
N4231_RS11960 (2440049) | 2440049..2440957 | - | 909 | WP_010989018.1 | hypothetical protein | - |
N4231_RS11965 (2441100) | 2441100..2441432 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
N4231_RS11970 (2441422) | 2441422..2441637 | - | 216 | WP_000206207.1 | hypothetical protein | - |
N4231_RS11975 (2441789) | 2441789..2442037 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4231_RS11980 (2442027) | 2442027..2442311 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4231_RS11985 (2442482) | 2442482..2442871 | + | 390 | WP_000194089.1 | RidA family protein | - |
N4231_RS11990 (2442923) | 2442923..2444002 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4231_RS11995 (2444195) | 2444195..2444683 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4231_RS12000 (2444728) | 2444728..2446236 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2437008..2449093 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T258083 WP_000221343.1 NZ_CP104484:2442027-2442311 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |