Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4606333..4607087 | Replicon | chromosome |
| Accession | NZ_CP104482 | ||
| Organism | Salmonella enterica strain SalSpp_sample_08_No.4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | N4230_RS22400 | Protein ID | WP_000558163.1 |
| Coordinates | 4606333..4606644 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4230_RS22405 | Protein ID | WP_001259011.1 |
| Coordinates | 4606641..4607087 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4230_RS22370 (4601991) | 4601991..4602893 | + | 903 | WP_000331362.1 | formate dehydrogenase subunit beta | - |
| N4230_RS22375 (4602890) | 4602890..4603525 | + | 636 | WP_000829028.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4230_RS22380 (4603522) | 4603522..4604451 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| N4230_RS22385 (4604498) | 4604498..4604788 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4230_RS22390 (4604789) | 4604789..4605100 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4230_RS22395 (4605318) | 4605318..4606247 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| N4230_RS22400 (4606333) | 4606333..4606644 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4230_RS22405 (4606641) | 4606641..4607087 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4230_RS22410 (4607102) | 4607102..4608043 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4230_RS22415 (4608088) | 4608088..4608525 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| N4230_RS22420 (4608522) | 4608522..4609394 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N4230_RS22425 (4609388) | 4609388..4609987 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N4230_RS22430 (4610178) | 4610178..4610981 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4230_RS22435 (4611015) | 4611015..4611911 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T258072 WP_000558163.1 NZ_CP104482:4606333-4606644 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT258072 WP_001259011.1 NZ_CP104482:4606641-4607087 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|