Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4719286..4719888 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V7IUJ1 |
Locus tag | N4G50_RS23075 | Protein ID | WP_001159632.1 |
Coordinates | 4719577..4719888 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4G50_RS23070 | Protein ID | WP_000362050.1 |
Coordinates | 4719286..4719576 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS23055 (4716779) | 4716779..4717681 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
N4G50_RS23060 (4717678) | 4717678..4718313 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
N4G50_RS23065 (4718310) | 4718310..4719239 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
N4G50_RS23070 (4719286) | 4719286..4719576 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
N4G50_RS23075 (4719577) | 4719577..4719888 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
N4G50_RS23080 (4720106) | 4720106..4721020 | + | 915 | WP_024157298.1 | alpha/beta hydrolase | - |
N4G50_RS23085 (4721046) | 4721046..4721987 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
N4G50_RS23090 (4722032) | 4722032..4722469 | - | 438 | WP_000560973.1 | D-aminoacyl-tRNA deacylase | - |
N4G50_RS23095 (4722466) | 4722466..4723338 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
N4G50_RS23100 (4723332) | 4723332..4723931 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12342.27 Da Isoelectric Point: 9.4460
>T258056 WP_001159632.1 NZ_CP104479:c4719888-4719577 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|