Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1851598..1851780 | Replicon | chromosome |
| Accession | NZ_CP104478 | ||
| Organism | Staphylococcus aureus strain DSM 20231 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | N1060_RS08995 | Protein ID | WP_001801861.1 |
| Coordinates | 1851598..1851693 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1851721..1851780 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1060_RS08955 (N1060_08955) | 1847258..1847884 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| N1060_RS08960 (N1060_08960) | 1847925..1848269 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| N1060_RS08965 (N1060_08965) | 1848367..1848918 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| N1060_RS08970 (N1060_08970) | 1849136..1849777 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N1060_RS08975 (N1060_08975) | 1849891..1850076 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| N1060_RS08980 (N1060_08980) | 1850078..1850254 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| N1060_RS08985 (N1060_08985) | 1850265..1850648 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| N1060_RS08990 (N1060_08990) | 1851252..1851395 | - | 144 | WP_001549059.1 | transposase | - |
| N1060_RS08995 (N1060_08995) | 1851598..1851693 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1851721..1851780 | - | 60 | - | - | Antitoxin |
| N1060_RS09000 (N1060_09000) | 1851816..1851917 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| N1060_RS09005 (N1060_09005) | 1851895..1852071 | - | 177 | Protein_1771 | transposase | - |
| N1060_RS09010 (N1060_09010) | 1852265..1852642 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1825571..1884869 | 59298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T258031 WP_001801861.1 NZ_CP104478:1851598-1851693 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT258031 NZ_CP104478:c1851780-1851721 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
