Detailed information of TA system TA258030

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 854944..855367
• Replicon: chromosome
• Accession: NZ_CP104478
• Organism: Staphylococcus aureus strain DSM 20231

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: N1060_RS04195
• Protein ID: WP_001836226.1
• Coordinates: 854944..855195 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: N1060_RS04200
• Protein ID: WP_000028421.1
• Coordinates: 855185..855367 (+)
• Length: 61 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N1060_RS04135 (N1060_04135)	850497..850646	+	150	WP_001081076.1	hypothetical protein	-
N1060_RS04140 (N1060_04140)	850639..850920	-	282	WP_000414755.1	hypothetical protein	-
N1060_RS04145 (N1060_04145)	850986..851756	+	771	WP_001836222.1	conserved phage C-terminal domain-containing protein	-
N1060_RS04150 (N1060_04150)	851766..852545	+	780	WP_000803062.1	ATP-binding protein	-
N1060_RS04155 (N1060_04155)	852539..852697	+	159	WP_000256589.1	hypothetical protein	-
N1060_RS04160 (N1060_04160)	852710..852931	+	222	WP_001123695.1	DUF3269 family protein	-
N1060_RS04165 (N1060_04165)	852941..853345	+	405	WP_001836225.1	DUF1064 domain-containing protein	-
N1060_RS04170 (N1060_04170)	853350..853535	+	186	WP_001187243.1	DUF3113 family protein	-
N1060_RS04175 (N1060_04175)	853536..853841	+	306	WP_000101252.1	hypothetical protein	-
N1060_RS04180 (N1060_04180)	853969..854325	+	357	WP_000029376.1	SA1788 family PVL leukocidin-associated protein	-
N1060_RS04185 (N1060_04185)	854329..854571	+	243	WP_001562543.1	SAV1978 family virulence-associated passenger protein	-
N1060_RS04190 (N1060_04190)	854580..854951	+	372	WP_001557190.1	hypothetical protein	-
N1060_RS04195 (N1060_04195)	854944..855195	+	252	WP_001836226.1	DUF1024 family protein	Toxin
N1060_RS04200 (N1060_04200)	855185..855367	+	183	WP_000028421.1	hypothetical protein	Antitoxin
N1060_RS04205 (N1060_04205)	855360..855890	+	531	WP_000185651.1	dUTP pyrophosphatase	-
N1060_RS04210 (N1060_04210)	855927..856133	+	207	WP_000195785.1	DUF1381 domain-containing protein	-
N1060_RS04215 (N1060_04215)	856130..856324	+	195	WP_000132920.1	hypothetical protein	-
N1060_RS04220 (N1060_04220)	856321..856524	+	204	WP_001072794.1	hypothetical protein	-
N1060_RS04225 (N1060_04225)	856517..856690	+	174	WP_001657250.1	transcriptional activator RinB	-
N1060_RS04230 (N1060_04230)	856691..856837	+	147	WP_000990005.1	hypothetical protein	-
N1060_RS04235 (N1060_04235)	856861..857283	+	423	WP_000162701.1	RinA family phage transcriptional activator	-
N1060_RS04240 (N1060_04240)	857471..857965	+	495	WP_001038244.1	terminase small subunit	-
N1060_RS04245 (N1060_04245)	857968..859263	+	1296	WP_001836232.1	PBSX family phage terminase large subunit	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	839710..884787	45077

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9457.35 Da
• Isoelectric Point: 3.8049

>T258030 WP_001836226.1 NZ_CP104478:854944-855195 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIYLDEAVGIMTGQVVYKYEEEQE
NEH

Nucleotide

• Length: 252 bp

Antitoxin

Protein

• Length: 61 a.a.
• Molecular weight: 6683.59 Da
• Isoelectric Point: 4.3791

>AT258030 WP_000028421.1 NZ_CP104478:855185-855367 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEAQEND

Nucleotide

• Length: 183 bp