Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2437045..2437229 | Replicon | chromosome |
Accession | NZ_CP104476 | ||
Organism | Staphylococcus aureus strain DSM 20231-Res2 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | N2W57_RS12150 | Protein ID | WP_000482650.1 |
Coordinates | 2437122..2437229 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2437045..2437105 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2W57_RS12135 (N2W57_12135) | 2432575..2432742 | - | 168 | WP_001790576.1 | hypothetical protein | - |
N2W57_RS12140 (N2W57_12140) | 2432973..2434706 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
N2W57_RS12145 (N2W57_12145) | 2434731..2436494 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
- | 2437045..2437105 | + | 61 | - | - | Antitoxin |
N2W57_RS12150 (N2W57_12150) | 2437122..2437229 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
N2W57_RS12155 (N2W57_12155) | 2437363..2437749 | - | 387 | WP_000779358.1 | flippase GtxA | - |
N2W57_RS12160 (N2W57_12160) | 2438017..2439159 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
N2W57_RS12165 (N2W57_12165) | 2439219..2439878 | + | 660 | WP_000831298.1 | membrane protein | - |
N2W57_RS12170 (N2W57_12170) | 2440060..2441271 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
N2W57_RS12175 (N2W57_12175) | 2441394..2441867 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T258027 WP_000482650.1 NZ_CP104476:c2437229-2437122 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT258027 NZ_CP104476:2437045-2437105 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|