Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1851594..1851782 | Replicon | chromosome |
| Accession | NZ_CP104476 | ||
| Organism | Staphylococcus aureus strain DSM 20231-Res2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | N2W57_RS08995 | Protein ID | WP_265474863.1 |
| Coordinates | 1851594..1851695 (+) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1851723..1851782 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2W57_RS08955 (N2W57_08955) | 1847259..1847885 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| N2W57_RS08960 (N2W57_08960) | 1847926..1848270 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| N2W57_RS08965 (N2W57_08965) | 1848368..1848919 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| N2W57_RS08970 (N2W57_08970) | 1849137..1849778 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N2W57_RS08975 (N2W57_08975) | 1849892..1850077 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| N2W57_RS08980 (N2W57_08980) | 1850079..1850255 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| N2W57_RS08985 (N2W57_08985) | 1850266..1850649 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| N2W57_RS08990 (N2W57_08990) | 1851253..1851396 | - | 144 | WP_001549059.1 | transposase | - |
| N2W57_RS08995 (N2W57_08995) | 1851594..1851695 | + | 102 | WP_265474863.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1851723..1851782 | - | 60 | - | - | Antitoxin |
| N2W57_RS09000 (N2W57_09000) | 1851818..1851919 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| N2W57_RS09005 (N2W57_09005) | 1851897..1852073 | - | 177 | Protein_1771 | transposase | - |
| N2W57_RS09010 (N2W57_09010) | 1852267..1852644 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1825572..1884871 | 59299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3651.42 Da Isoelectric Point: 10.4449
>T258022 WP_265474863.1 NZ_CP104476:1851594-1851695 [Staphylococcus aureus]
ITIIIFVHIIAPVISGCAIAFFSYWLSRRNTK
ITIIIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 102 bp
Antitoxin
Download Length: 60 bp
>AT258022 NZ_CP104476:c1851782-1851723 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|