Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1851594..1851782 Replicon chromosome
Accession NZ_CP104476
Organism Staphylococcus aureus strain DSM 20231-Res2

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag N2W57_RS08995 Protein ID WP_265474863.1
Coordinates 1851594..1851695 (+) Length 34 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1851723..1851782 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2W57_RS08955 (N2W57_08955) 1847259..1847885 + 627 WP_000669046.1 hypothetical protein -
N2W57_RS08960 (N2W57_08960) 1847926..1848270 + 345 WP_000627551.1 DUF3969 family protein -
N2W57_RS08965 (N2W57_08965) 1848368..1848919 + 552 WP_000414205.1 hypothetical protein -
N2W57_RS08970 (N2W57_08970) 1849137..1849778 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
N2W57_RS08975 (N2W57_08975) 1849892..1850077 - 186 WP_000809857.1 hypothetical protein -
N2W57_RS08980 (N2W57_08980) 1850079..1850255 - 177 WP_000375476.1 hypothetical protein -
N2W57_RS08985 (N2W57_08985) 1850266..1850649 - 384 WP_000070812.1 hypothetical protein -
N2W57_RS08990 (N2W57_08990) 1851253..1851396 - 144 WP_001549059.1 transposase -
N2W57_RS08995 (N2W57_08995) 1851594..1851695 + 102 WP_265474863.1 type I toxin-antitoxin system Fst family toxin Toxin
- 1851723..1851782 - 60 - - Antitoxin
N2W57_RS09000 (N2W57_09000) 1851818..1851919 + 102 WP_001791893.1 hypothetical protein -
N2W57_RS09005 (N2W57_09005) 1851897..1852073 - 177 Protein_1771 transposase -
N2W57_RS09010 (N2W57_09010) 1852267..1852644 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1825572..1884871 59299


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 34 a.a.        Molecular weight: 3651.42 Da        Isoelectric Point: 10.4449

>T258022 WP_265474863.1 NZ_CP104476:1851594-1851695 [Staphylococcus aureus]
ITIIIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 102 bp

Antitoxin


Download         Length: 60 bp

>AT258022 NZ_CP104476:c1851782-1851723 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References