Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 45115..45369 Replicon plasmid pUC4224_1
Accession NZ_CP104473
Organism Escherichia coli strain UC4224

Toxin (Protein)


Gene name srnB Uniprot ID A0A148HBD8
Locus tag N4S17_RS24790 Protein ID WP_001336447.1
Coordinates 45115..45264 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 45308..45369 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4S17_RS24760 (40648) 40648..41070 - 423 WP_028985400.1 Exc2 family lipoprotein -
N4S17_RS24765 (41353) 41353..41868 + 516 Protein_37 transposase -
N4S17_RS24770 (42199) 42199..42438 - 240 WP_000859018.1 winged helix-turn-helix transcriptional regulator -
N4S17_RS24775 (43414) 43414..44271 - 858 WP_028985401.1 incFII family plasmid replication initiator RepA -
N4S17_RS24780 (44264) 44264..44338 - 75 WP_062865987.1 RepA leader peptide Tap -
N4S17_RS24785 (44574) 44574..44831 - 258 WP_000084404.1 replication regulatory protein RepA -
N4S17_RS24790 (45115) 45115..45264 - 150 WP_001336447.1 Hok/Gef family protein Toxin
- (45308) 45308..45369 + 62 NuclAT_1 - Antitoxin
- (45308) 45308..45369 + 62 NuclAT_1 - Antitoxin
- (45308) 45308..45369 + 62 NuclAT_1 - Antitoxin
- (45308) 45308..45369 + 62 NuclAT_1 - Antitoxin
N4S17_RS24795 (45685) 45685..45927 - 243 WP_225303886.1 hypothetical protein -
N4S17_RS24800 (46030) 46030..46489 - 460 Protein_44 thermonuclease family protein -
N4S17_RS24805 (47232) 47232..47435 - 204 WP_032295436.1 hypothetical protein -
N4S17_RS24810 (47590) 47590..48147 - 558 WP_028985402.1 fertility inhibition protein FinO -
N4S17_RS24815 (48202) 48202..48948 - 747 WP_028985403.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC / espP 1..111840 111840


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5572.69 Da        Isoelectric Point: 8.7678

>T258015 WP_001336447.1 NZ_CP104473:c45264-45115 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT258015 NZ_CP104473:45308-45369 [Escherichia coli]
TTGAGATACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A148HBD8

Antitoxin

Download structure file

References