Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4974821..4975042 | Replicon | chromosome |
| Accession | NZ_CP104472 | ||
| Organism | Escherichia coli strain UC4224 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | N4S17_RS24130 | Protein ID | WP_000170954.1 |
| Coordinates | 4974821..4974928 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4974976..4975042 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4S17_RS24105 (4970665) | 4970665..4971747 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| N4S17_RS24110 (4971747) | 4971747..4972580 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| N4S17_RS24115 (4972577) | 4972577..4972969 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| N4S17_RS24120 (4972973) | 4972973..4973782 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| N4S17_RS24125 (4973818) | 4973818..4974672 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| N4S17_RS24130 (4974821) | 4974821..4974928 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_38 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_38 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_38 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_38 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_40 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_40 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_40 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_40 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_42 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_42 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_42 | - | - |
| - (4974978) | 4974978..4975041 | + | 64 | NuclAT_42 | - | - |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_27 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_29 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_33 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_35 | - | Antitoxin |
| - (4974976) | 4974976..4975042 | + | 67 | NuclAT_35 | - | Antitoxin |
| N4S17_RS24135 (4975356) | 4975356..4975463 | - | 108 | WP_000170925.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_37 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_37 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_37 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_37 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_39 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_39 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_39 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_39 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_41 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_41 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_41 | - | - |
| - (4975516) | 4975516..4975577 | + | 62 | NuclAT_41 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_26 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_26 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_26 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_26 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_28 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_28 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_28 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_28 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_30 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_30 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_30 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_30 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_32 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_32 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_32 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_32 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_34 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_34 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_34 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_34 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_36 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_36 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_36 | - | - |
| - (4975516) | 4975516..4975578 | + | 63 | NuclAT_36 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_14 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_14 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_14 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_14 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_16 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_16 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_16 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_16 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_18 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_18 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_18 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_18 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_20 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_20 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_20 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_20 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_22 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_22 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_22 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_22 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_24 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_24 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_24 | - | - |
| - (4975516) | 4975516..4975579 | + | 64 | NuclAT_24 | - | - |
| N4S17_RS24140 (4975892) | 4975892..4975999 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_13 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_13 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_13 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_13 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_15 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_15 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_15 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_15 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_17 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_17 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_17 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_17 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_19 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_19 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_19 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_19 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_21 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_21 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_21 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_21 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_23 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_23 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_23 | - | - |
| - (4976047) | 4976047..4976114 | + | 68 | NuclAT_23 | - | - |
| N4S17_RS24145 (4976404) | 4976404..4977504 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| N4S17_RS24150 (4977774) | 4977774..4978004 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| N4S17_RS24155 (4978162) | 4978162..4978857 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| N4S17_RS24160 (4978901) | 4978901..4979254 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T258010 WP_000170954.1 NZ_CP104472:c4974928-4974821 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT258010 NZ_CP104472:4974976-4975042 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
