Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3588105..3588363 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | N4S17_RS17355 | Protein ID | WP_000809168.1 |
Coordinates | 3588105..3588257 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3588306..3588363 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS17335 | 3583346..3584059 | - | 714 | WP_028985301.1 | acidic protein MsyB | - |
N4S17_RS17340 | 3584085..3584489 | - | 405 | WP_000843559.1 | DUF2541 family protein | - |
N4S17_RS17345 | 3584866..3586782 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
N4S17_RS17350 | 3586871..3588001 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
N4S17_RS17355 | 3588105..3588257 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3588306..3588363 | + | 58 | - | - | Antitoxin |
N4S17_RS17360 | 3588843..3590009 | + | 1167 | WP_028985302.1 | Na+/H+ antiporter NhaA | - |
N4S17_RS17365 | 3590075..3590974 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
N4S17_RS17370 | 3591013..3591972 | - | 960 | WP_000871659.1 | hypothetical protein | - |
N4S17_RS17375 | 3591985..3593337 | - | 1353 | Protein_3390 | fimbria/pilus outer membrane usher protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T258006 WP_000809168.1 NZ_CP104472:c3588257-3588105 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT258006 NZ_CP104472:3588306-3588363 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|