Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2969209..2969811 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N4S17_RS14425 | Protein ID | WP_000897305.1 |
Coordinates | 2969209..2969520 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4S17_RS14430 | Protein ID | WP_000356397.1 |
Coordinates | 2969521..2969811 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS14400 (2965123) | 2965123..2965722 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
N4S17_RS14405 (2965716) | 2965716..2966588 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N4S17_RS14410 (2966585) | 2966585..2967022 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N4S17_RS14415 (2967067) | 2967067..2968008 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N4S17_RS14420 (2968072) | 2968072..2968980 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N4S17_RS14425 (2969209) | 2969209..2969520 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N4S17_RS14430 (2969521) | 2969521..2969811 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N4S17_RS14435 (2970397) | 2970397..2970615 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N4S17_RS14440 (2970834) | 2970834..2971076 | + | 243 | WP_001086388.1 | protein YiiF | - |
N4S17_RS14445 (2971305) | 2971305..2972285 | - | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
N4S17_RS14450 (2972684) | 2972684..2973613 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
N4S17_RS14455 (2973610) | 2973610..2974245 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2971305..2972285 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T258002 WP_000897305.1 NZ_CP104472:2969209-2969520 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|