Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2161919..2162718 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | N4S17_RS10505 | Protein ID | WP_000347266.1 |
Coordinates | 2162254..2162718 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N4S17_RS10500 | Protein ID | WP_001307405.1 |
Coordinates | 2161919..2162254 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS10485 (2157704) | 2157704..2158474 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N4S17_RS10490 (2158490) | 2158490..2159824 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N4S17_RS10495 (2160199) | 2160199..2161770 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
N4S17_RS10500 (2161919) | 2161919..2162254 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N4S17_RS10505 (2162254) | 2162254..2162718 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N4S17_RS10510 (2162773) | 2162773..2163582 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N4S17_RS10515 (2163831) | 2163831..2165111 | + | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N4S17_RS10520 (2165134) | 2165134..2165607 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N4S17_RS10525 (2165618) | 2165618..2166397 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N4S17_RS10530 (2166387) | 2166387..2167265 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N4S17_RS10535 (2167283) | 2167283..2167717 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2151263..2162718 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T258000 WP_000347266.1 NZ_CP104472:2162254-2162718 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |