Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 276054..276639 Replicon plasmid unnamed2
Accession NZ_CP104447
Organism Acinetobacter baumannii strain 2021CK-01407

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag N5T86_RS01190 Protein ID WP_000897307.1
Coordinates 276054..276374 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N5T86_RS01195 Protein ID WP_000369781.1
Coordinates 276367..276639 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5T86_RS01150 (N5T86_01155) 271359..272195 + 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N5T86_RS01155 (N5T86_01160) 272385..272672 + 288 WP_000438825.1 BrnT family toxin -
N5T86_RS01160 (N5T86_01165) 272659..272973 + 315 WP_004728120.1 BrnA antitoxin family protein -
N5T86_RS01165 (N5T86_01170) 273140..273583 - 444 WP_260744098.1 hypothetical protein -
N5T86_RS01170 (N5T86_01175) 273661..274629 + 969 WP_252513945.1 IS30 family transposase -
N5T86_RS01175 (N5T86_01180) 274831..275133 + 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5T86_RS01180 (N5T86_01185) 275134..275415 + 282 WP_000985609.1 putative addiction module antidote protein -
N5T86_RS01185 (N5T86_01190) 275495..275914 - 420 WP_001180106.1 SMI1/KNR4 family protein -
N5T86_RS01190 (N5T86_01195) 276054..276374 + 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5T86_RS01195 (N5T86_01200) 276367..276639 + 273 WP_000369781.1 NadS family protein Antitoxin
N5T86_RS01200 (N5T86_01205) 277132..278607 + 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N5T86_RS01205 (N5T86_01210) 278663..279547 + 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N5T86_RS01210 (N5T86_01215) 279737..280348 - 612 WP_015060246.1 recombinase family protein -
N5T86_RS01215 (N5T86_01220) 280604..281020 + 417 WP_000147519.1 hypothetical protein -
N5T86_RS01220 (N5T86_01225) 281041..281283 + 243 WP_001229660.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaOXA-58 / tet(X3) / sul2 / aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / ARR-3 / qacE / sul1 / blaNDM-1 / aph(3')-VI - 1..335722 335722
- inside IScluster/Tn aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) - 261718..279547 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T257951 WP_000897307.1 NZ_CP104447:276054-276374 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT257951 WP_000369781.1 NZ_CP104447:276367-276639 [Acinetobacter baumannii]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References