Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4860720..4861322 | Replicon | chromosome |
Accession | NZ_CP104442 | ||
Organism | Escherichia coli strain HBUT-L |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N1H43_RS23685 | Protein ID | WP_000897305.1 |
Coordinates | 4860720..4861031 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1H43_RS23690 | Protein ID | WP_000356397.1 |
Coordinates | 4861032..4861322 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H43_RS23655 (4855750) | 4855750..4856535 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
N1H43_RS23660 (4856634) | 4856634..4857233 | + | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
N1H43_RS23665 (4857227) | 4857227..4858099 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N1H43_RS23670 (4858096) | 4858096..4858533 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N1H43_RS23675 (4858578) | 4858578..4859519 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N1H43_RS23680 (4859583) | 4859583..4860491 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N1H43_RS23685 (4860720) | 4860720..4861031 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N1H43_RS23690 (4861032) | 4861032..4861322 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N1H43_RS23695 (4861927) | 4861927..4862145 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N1H43_RS23700 (4862364) | 4862364..4862606 | + | 243 | WP_001086388.1 | protein YiiF | - |
N1H43_RS23705 (4862936) | 4862936..4863865 | - | 930 | WP_000027702.1 | formate dehydrogenase accessory protein FdhE | - |
N1H43_RS23710 (4863862) | 4863862..4864497 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1H43_RS23715 (4864494) | 4864494..4865396 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T257948 WP_000897305.1 NZ_CP104442:4860720-4861031 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|