Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4042905..4043704 | Replicon | chromosome |
Accession | NZ_CP104442 | ||
Organism | Escherichia coli strain HBUT-L |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | N1H43_RS19670 | Protein ID | WP_000347267.1 |
Coordinates | 4043240..4043704 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N1H43_RS19665 | Protein ID | WP_001307405.1 |
Coordinates | 4042905..4043240 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H43_RS19650 (4038690) | 4038690..4039460 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
N1H43_RS19655 (4039476) | 4039476..4040810 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N1H43_RS19660 (4041185) | 4041185..4042756 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
N1H43_RS19665 (4042905) | 4042905..4043240 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N1H43_RS19670 (4043240) | 4043240..4043704 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N1H43_RS19675 (4043759) | 4043759..4044568 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N1H43_RS19680 (4044817) | 4044817..4046097 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N1H43_RS19685 (4046120) | 4046120..4046593 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N1H43_RS19690 (4046604) | 4046604..4047383 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N1H43_RS19695 (4047373) | 4047373..4048251 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N1H43_RS19700 (4048269) | 4048269..4048703 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4033870..4043704 | 9834 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T257944 WP_000347267.1 NZ_CP104442:4043240-4043704 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |