Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2083916..2084287 | Replicon | chromosome |
| Accession | NZ_CP104442 | ||
| Organism | Escherichia coli strain HBUT-L | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | N1H43_RS10070 | Protein ID | WP_001317028.1 |
| Coordinates | 2084093..2084287 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2083916..2084094 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H43_RS10045 (2079871) | 2079871..2081244 | + | 1374 | WP_000123740.1 | ATP-dependent RNA helicase DbpA | - |
| N1H43_RS10050 (2081373) | 2081373..2082308 | - | 936 | WP_001157422.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| N1H43_RS10055 (2082360) | 2082360..2083595 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| N1H43_RS10060 (2083597) | 2083597..2083812 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2083916) | 2083916..2084094 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2083916) | 2083916..2084094 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2083916) | 2083916..2084094 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2083916) | 2083916..2084094 | + | 179 | NuclAT_0 | - | Antitoxin |
| N1H43_RS10065 (2083891) | 2083891..2084100 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| N1H43_RS10070 (2084093) | 2084093..2084287 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| N1H43_RS10075 (2084344) | 2084344..2085153 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| N1H43_RS10080 (2085146) | 2085146..2087746 | - | 2601 | WP_000105152.1 | exodeoxyribonuclease VIII | - |
| N1H43_RS10085 (2087848) | 2087848..2088123 | - | 276 | WP_001349884.1 | hypothetical protein | - |
| N1H43_RS10090 (2088198) | 2088198..2088368 | - | 171 | WP_001349883.1 | YdaE family protein | - |
| N1H43_RS10095 (2088368) | 2088368..2088589 | - | 222 | WP_000560220.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2075101..2132554 | 57453 | |
| - | flank | IS/Tn | - | - | 2088745..2089953 | 1208 | |
| - | inside | Prophage | - | - | 2072170..2132554 | 60384 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T257930 WP_001317028.1 NZ_CP104442:c2084287-2084093 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT257930 NZ_CP104442:2083916-2084094 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|